PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_8.223
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 758aa    MW: 82414.6 Da    PI: 5.6671
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_8.223genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2093148156
                                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                  +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  evm.model.supercontig_8.223  93 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 148
                                  688999***********************************************999 PP

2START220.36.2e-692835031206
                                  HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT- CS
                        START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWd 73 
                                  ela +a++el+++a+ +ep+W+       + +n++e++++f+++ +     ++ ea+r++ vv+m++ +lve+l+d++ qW+
  evm.model.supercontig_8.223 283 ELAVAAMEELIRMAQMGEPLWMIALdgatSVLNEEEYMRTFPRGIGlkpagYKCEASRETSVVIMNHINLVEILMDVN-QWS 363
                                  57899********************999999************999********************************.*** PP

                                  TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE CS
                        START  74 etla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvR 144
                                  + +     +a+tlev+s+g      galq+m+ e+q+++plvp R++++vRy++q+g+g w++vdvS+ds ++ p+    +R
  evm.model.supercontig_8.223 364 TVFSgivsRAMTLEVLSTGvagnynGALQVMTVEFQVPTPLVPtRESYYVRYCKQHGEGMWAVVDVSLDSLRPAPT----AR 441
                                  **************************************************************************96....** PP

                                  -EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                        START 145 aellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                  ++++pSg+li++++ng+skv+wvehv++++r +h+l++ lv+sg+a+gak+wvatl+rqce+
  evm.model.supercontig_8.223 442 CRRRPSGCLIQEMPNGYSKVIWVEHVEVDDRGVHNLYKNLVNSGHAFGAKRWVATLERQCER 503
                                  ************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2272148IPR009057Homeodomain-like
SuperFamilySSF466891.3E-1982150IPR009057Homeodomain-like
PROSITE profilePS5007116.95790150IPR001356Homeobox domain
SMARTSM003898.4E-2091154IPR001356Homeobox domain
PfamPF000464.3E-1893148IPR001356Homeobox domain
CDDcd000862.67E-1993151No hitNo description
PROSITE patternPS000270125148IPR017970Homeobox, conserved site
PROSITE profilePS5084844.059274506IPR002913START domain
SuperFamilySSF559615.22E-36275505No hitNo description
CDDcd088751.04E-127278502No hitNo description
SMARTSM002341.2E-63283503IPR002913START domain
PfamPF018523.4E-58284503IPR002913START domain
Gene3DG3DSA:3.30.530.201.9E-5380503IPR023393START-like domain
SuperFamilySSF559615.49E-24521749No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010090Biological Processtrichome morphogenesis
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MPAGFMVPAR NMPSMIGMGG NNIGGFASSS SGLSLGQPNM MEGQLIPLEM TQTSESDQIA  60
RMRDEELDST TKSGSENLEG ASGDDGQDPR PKKKRYHRHT QHQIQEMEAF FKECPHPDDK  120
QRKELSRELG LEPLQVKFWF QNKRTQMKTQ HERQENTQLR SENEKLRADN MRYRDALSNA  180
SCPNCGGPTA IGEMSFDEHH LRLENARLRE EIDRISAIAA KYVGKPVMNY PLLSSPAPSR  240
PLDLAVGNFG GQQAGIGGEM YGAGDLMRSF APPAEADKPM IIELAVAAME ELIRMAQMGE  300
PLWMIALDGA TSVLNEEEYM RTFPRGIGLK PAGYKCEASR ETSVVIMNHI NLVEILMDVN  360
QWSTVFSGIV SRAMTLEVLS TGVAGNYNGA LQVMTVEFQV PTPLVPTRES YYVRYCKQHG  420
EGMWAVVDVS LDSLRPAPTA RCRRRPSGCL IQEMPNGYSK VIWVEHVEVD DRGVHNLYKN  480
LVNSGHAFGA KRWVATLERQ CERLASVMAT NVPTADLGVI SNQEGRKSML KLAERMVNSF  540
CAGVSASTAH TWTTLSGTGA DDVRVMTRKS VDDPGRPPGI VLSAATSFWL PVHPKVVFDF  600
LRDDNSRNEW DILSNGGVVS EMAHIANGRD TGNSVSLLRV NSVNSSQSNM LILQESGTDA  660
TGSFVVYAPV DIVAMNVVLN GGDPDYVALL PSGFAILPDG AGVNQGGSGG SLLTVAFQIL  720
VDSVPTAKLS LGSVATVNNL IACTVERIKA ALSCDAA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007045611.10.0Homeodomain GLABROUS 2 isoform 1
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLA0A061E9X10.0A0A061E9X1_THECC; Homeodomain GLABROUS 2 isoform 1
STRINGPOPTR_0014s15010.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2